PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009600160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 1059aa    MW: 118414 Da    PI: 6.7248
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009600160.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.81e-07331424147
                      TSSS-HHHHHHHHHHHHHTTTT...............................................-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...............................................tWktIartmgkgRtlkqcksrwqky 47 
                      r+ W++eE e l+++vkq   +                                               +W+ +a++   gR++ +c+srw+++
   XP_009600160.1 331 RKEWSKEERENLAKGVKQQFQEmllqrsvdllsnedgrsgesgdldgliasirdvvitpetmrlflpkvNWDQVASMYIPGRSGAECQSRWLNW 424
                      789****************999******************************************************9888************98 PP

2Myb_DNA-binding41.43.4e-13484528146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r  WT+eEd +l  av+ +G  +W ++a+ +  gRt+ qc +rw k
   XP_009600160.1 484 RREWTEEEDIKLCAAVETFGESNWQLVASVIE-GRTGPQCSNRWIK 528
                      678*****************************.***********87 PP

3Myb_DNA-binding37.36.4e-12538595246
                      SSS-HHHHHHHHHHHHHTTTT..............-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGgg..............tWktIartmgkgRtlkqcksrwqk 46 
                      g+W+++Ed++l+ av ++ ++               Wk+I ++++ gRt  qc++rw +
   XP_009600160.1 538 GKWSADEDKRLKVAVMLFHPKswrnigqsvpcrapIWKKITQYVP-GRTHVQCRERWVN 595
                      89*****************99************************.***********87 PP

4Myb_DNA-binding482.8e-15605647347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eEd++l+ a+ ++G   W+++a++++  Rt++qc+ rw  +
   XP_009600160.1 605 KWTEEEDLKLKSAIDEHGYS-WSKVAACVP-PRTDNQCRRRWKVL 647
                      8*****************99.*********.9**********865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.992326425IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.605.3E-10329352IPR009057Homeodomain-like
SMARTSM007172.2E-6330427IPR001005SANT/Myb domain
CDDcd001670.00409388424No hitNo description
Gene3DG3DSA:1.10.10.605.3E-10400434IPR009057Homeodomain-like
SuperFamilySSF466891.69E-12407475IPR009057Homeodomain-like
PROSITE profilePS500906.98426478IPR017877Myb-like domain
SMARTSM007170.022430480IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-8435484IPR009057Homeodomain-like
SuperFamilySSF466893.04E-18464535IPR009057Homeodomain-like
PROSITE profilePS5129418.915479534IPR017930Myb domain
SMARTSM007171.1E-12483532IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-15485534IPR009057Homeodomain-like
CDDcd001672.45E-10486530No hitNo description
PfamPF139211.6E-11487548No hitNo description
PROSITE profilePS500908.595532597IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.606.1E-13535587IPR009057Homeodomain-like
SMARTSM007172.9E-8536599IPR001005SANT/Myb domain
CDDcd001671.22E-5539597No hitNo description
SuperFamilySSF466891.36E-24577649IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-20588645IPR009057Homeodomain-like
PROSITE profilePS5129422.756598652IPR017930Myb domain
SMARTSM007174.1E-14602650IPR001005SANT/Myb domain
CDDcd001673.96E-12605648No hitNo description
PfamPF002492.4E-14605646IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1059 aa     Download sequence    Send to blast
MAFDDDEDFS GSDSDDGFKE DMEALKKACL LAGKETDDLQ PSCSTGDIGG GHVTGSDDVT  60
PSGTDADDVD DDIELVRSIQ ERFALSTELR EPLTLKPLCS LPPPGSEGDD GDDDFETLRA  120
IQRRFAAYDD DSGKGRKESP LDNFEQVGVT NITSEKESSN NFFVERTNAG EGFPACVDGT  180
TQISDGCSNE IASSQNLIEW HDSGAENTAV SVNSFCFPKS AQAFVEAIKK NRSCQKIIRD  240
KMMQIEARIE ELKKLKERVK ILKGFQIASR KRMGRALSQK RDARVQLISL PKQKCSSKGK  300
KLSAMHYGPP ENSHVASVRE ALTHFAVSLS RKEWSKEERE NLAKGVKQQF QEMLLQRSVD  360
LLSNEDGRSG ESGDLDGLIA SIRDVVITPE TMRLFLPKVN WDQVASMYIP GRSGAECQSR  420
WLNWEDPLIK HEEWAILEEK ALLHAVQRNE MSNWVDISAS LGVCRTPFQC LSHYQRSLNA  480
SILRREWTEE EDIKLCAAVE TFGESNWQLV ASVIEGRTGP QCSNRWIKSL HPTRKRCGKW  540
SADEDKRLKV AVMLFHPKSW RNIGQSVPCR APIWKKITQY VPGRTHVQCR ERWVNSLDPS  600
LNLDKWTEEE DLKLKSAIDE HGYSWSKVAA CVPPRTDNQC RRRWKVLFPD EVPMLQEAKK  660
IRREAFISNF VDREEERPAL RPNDIVPTHK LSYRAGCETA SANKKRKLRP RAARDDSAPR  720
CDALCELERR HLEESEGPES SDLLNNSSLS SRDQEIERIS DGEEAFELGY HDSTKNKRPS  780
KLHPRRTKKL APNDMVPEAS ASSKVESTTA VNNICKNRRR TSSLVKKKKT IASQESSSSL  840
PNLSSSMTVV EEVDSHVQDS GKTMNVMDKC HSTSGYDDSC VNSEGPPLSC PHLDKGTADL  900
DVGENRVWEN ASTIGPQEAS LYFQKNAVVC TDENARQLKA SGCHKLNKCN QLKSDGRFSV  960
NNLRETADDC MTLASFILKS RAKRRSLSSA KVAKLRPDIA QSTGVAEDHS SRSCISGGHD  1020
GVEKTMTQEC TSSNQISGAE VADDMPLSLV MGRVKRRQR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-254346446155MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-254346446155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2389741e-111AC238974.1 Solanum tuberosum clone RHPOTKEY152M21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009600160.10.0PREDICTED: uncharacterized protein LOC104095683 isoform X2
TrEMBLA0A0V0IVV70.0A0A0V0IVV7_SOLCH; Putative ovule protein (Fragment)
STRINGSolyc03g119050.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-168myb domain protein 4r1